Is this product for human or veterinary use?

No. Aero Peptides materials are sold exclusively for in-vitro research and laboratory analytical use. They are not intended to diagnose, treat, cure, or prevent any disease, and are not approved for human or animal administration. By placing an order, you confirm that you are a qualified researcher and that the material will be used in accordance with all applicable institutional and jurisdictional regulations.

What does the Certificate of Analysis (COA) cover?

Each lot is independently tested for identity, purity, and mass using HPLC and mass spectrometry. The COA lists the lot number, test date, assay results, and the laboratory that performed the analysis. Public COA documents are being prepared. In the meantime, you can request a COA for your specific lot at /lab-results and we'll email it within 1 business day.

How is the product shipped and stored in transit?

Orders ship quickly after your order is placed, from the US. Lyophilized peptides are shipped with insulation appropriate to season; short-term ambient excursions during transit do not measurably affect potency. On receipt, store at -20°C in the sealed vial until reconstitution. Tracked shipping is included; we ship to all US states and most international destinations.

What does reconstitution look like in practice?

Most peptides are reconstituted with bacteriostatic water (BAC). The volume depends on the target working concentration. Use the Peptide Calculator at /reconstitution-calculator to compute volume, U-100 insulin syringe units, and doses per vial from peptide mass and target dose. Once reconstituted, store at 2-8°C and use within 30 days. Protect the vial from light during storage and handling.

Can I return or exchange a vial?

Because peptides are temperature-sensitive research materials, we cannot accept returns of opened or unsealed vials. If a shipment arrives damaged or the seal is broken on arrival, contact us within 7 days and we'll replace or refund. See the full returns policy at /returns for details.

Growth Hormone Support

Tesamorelin 10mg

Name: Tesamorelin (10mg)
SKU: aero-38
Price: 64.99 USD
Availability: InStock

EgriftaTH9507trans-3-hexenoyl GHRH(1-44)Stabilised GHRH analogue

Tesamorelin is a stabilised 44-amino-acid analogue of human growth hormone-releasing hormone (GHRH) bearing a trans-3-hexenoic acid modification at the N-terminal tyrosine residue. The acyl group confers resistance to dipeptidyl peptidase-IV cleavage, extending plasma half-life relative to native GHRH and prolonging stimulation of pituitary GHRH receptors. Published preclinical and clinical literature has characterised its pharmacokinetics, downstream growth-hormone and IGF-1 pulsatility, and effects on visceral adipose tissue and hepatic fat in randomised trials of HIV-associated lipodystrophy. AeroPeptides supplies tesamorelin for in vitro and ex vivo investigation of GHRH-receptor pharmacology, endocrine signalling, and adipose-tissue biology; findings from approved clinical populations should not be extrapolated to other contexts. For laboratory and research use only.

Dosage

10MG

$64.99

Peptide Calculator →

Quantity

Ships quickly after your order is placed

Damage protection

Secure checkout · 256-bit SSL

Research focus

How Tesamorelin is studied

Summary of contexts in which this compound appears in the preclinical literature. See cited studies for primary sources.

Areas of research interest

GHRH-receptor pharmacology
Growth-hormone pulsatility
IGF-1 axis signalling
Visceral adipose tissue models
Hepatic steatosis / NAFLD research
Dipeptidyl peptidase-IV resistance
Endocrine pharmacokinetics
Lipodystrophy investigations

Technical specifications

Compound & stability data

Compound Information

What is Tesamorelin (10mg)?

N-modified GHRH analogue (44 amino acids)

Type: N-modified GHRH analogue (44 amino acids)
CAS Number: 901758-09-6
Molecular Weight: 5135.81 g/mol
Amino Acids: 44
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Formula: C221H366N72O67S

View on PubChem ↗

Storage & Stability

Handling requirements

Lyophilized (powder)
-20°C • long-term stable in sealed lyophilized form
Reconstituted
2-8°C • use within 30 days of reconstitution
Light
Protect from light during storage and reconstitution
Room temperature
Short-term tolerant during shipping; minimise extended exposure above 25°C

Dosing in the literature

Research dosing context

Observational summary of values reported in published research. Not a guide for human or animal use.

Reconstitution
Typically 1–2 mL bacteriostatic water per 10 mg vial, yielding a ~5–10 mg/mL working concentration in research preparations.
Published protocols
Falutz et al. 2007 (NEJM, PMID 18057338) and the pooled phase 3 analysis (Falutz et al. 2010, JAIDS, PMID 20554713) used SC injections of 2 mg/day in HIV-associated lipodystrophy research cohorts. Stanley et al. 2011 (JCEM, PMID 20943777) characterised GH pulsatility and insulin-sensitivity effects at 2 mg/day SC in healthy men.
Half-life
~26–38 minutes in plasma following SC administration, as characterised by Chen et al. 2015 (Br J Clin Pharmacol, PMID 25358450) population PK analysis. The trans-3-hexenoyl modification confers DPP-IV resistance relative to native GHRH but does not extend half-life to the multi-day range seen with albumin-binding analogues.
Post-reconstitution stability
~28 days at 2–8 °C in BAC-water solution.

Half-life from Chen et al. 2015 (PMID 25358450). Published dose levels from Falutz et al. 2007 (PMID 18057338) and Falutz et al. 2010 (PMID 20554713) phase 3 trials in HIV-lipodystrophy cohorts.

Sources & references

Peer-reviewed research

New England Journal of Medicine

Metabolic effects of a growth hormone-releasing factor in patients with HIV

Falutz J, Allas S, Blot K, et al.

2007 · DOI: 10.1056/NEJMoa072375 · PMID: 18057338

Read on PubMed ↗

JAIDS Journal of Acquired Immune Deficiency Syndromes

Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension

Falutz J, Potvin D, Mamputu JC, et al.

2010 · DOI: 10.1097/QAI.0b013e3181cbdaff · PMID: 20101189

Read on PubMed ↗

JAIDS Journal of Acquired Immune Deficiency Syndromes

Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in HIV-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data

Falutz J, Mamputu JC, Potvin D, et al.

2010 · DOI: 10.1097/QAI.0b013e3181e6606c · PMID: 20554713

Read on PubMed ↗

JAMA

Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial

Stanley TL, Feldpausch MN, Oh J, et al.

2014 · DOI: 10.1001/jama.2014.8334 · PMID: 25038357

Read on PubMed ↗

The Lancet HIV

Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial

Stanley TL, Fourman LT, Feldpausch MN, et al.

2019 · DOI: 10.1016/S2352-3018(19)30338-8 · PMID: 31611038

Read on PubMed ↗

Growth Hormone & IGF Research

Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue

Ferdinandi ES, Brazeau P, High K, et al.

2007 · DOI: 10.1016/j.ghir.2006.11.001 · PMID: 17214611

Read on PubMed ↗

Journal of Clinical Endocrinology & Metabolism

Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men

Stanley TL, Chen CY, Branch KL, Makimura H, Grinspoon SK

2011 · DOI: 10.1210/jc.2010-1689 · PMID: 20943777

Read on PubMed ↗

British Journal of Clinical Pharmacology

Population pharmacokinetic analysis of tesamorelin in HIV-infected patients and healthy subjects

Chen J, Marbury T, Taylor T, et al.

2015 · DOI: 10.1111/bcp.12525 · PMID: 25358450

Read on PubMed ↗

Journal of Clinical Endocrinology & Metabolism

Reduction in visceral adiposity is associated with an improved metabolic profile in HIV-infected patients receiving tesamorelin

Stanley TL, Falutz J, Mamputu JC, Soulban G, Potvin D, Grinspoon SK

2012 · DOI: 10.1210/jc.2011-2767 · PMID: 22495074

Read on PubMed ↗

Clinical and Experimental Pharmacology & Physiology

A glimpse at growth hormone-releasing hormone cosmos

Barabutis N

2020 · DOI: 10.1111/1440-1681.13324 · PMID: 32289177

Read on PubMed ↗

10 peer-reviewed references listed. Citations verified against NCBI PubMed records. For research and educational reference only — does not constitute medical advice.

Researcher FAQ

Common questions

Is this product for human or veterinary use?
No. Aero Peptides materials are sold exclusively for in-vitro research and laboratory analytical use. They are not intended to diagnose, treat, cure, or prevent any disease, and are not approved for human or animal administration.
By placing an order, you confirm that you are a qualified researcher and that the material will be used in accordance with all applicable institutional and jurisdictional regulations.
What does the Certificate of Analysis (COA) cover?
Each lot is independently tested for identity, purity, and mass using HPLC and mass spectrometry. The COA lists the lot number, test date, assay results, and the laboratory that performed the analysis.
Public COA documents are being prepared. In the meantime, you can request a COA for your specific lot and we’ll email it within 1 business day.
How is the product shipped and stored in transit?
Orders ship quickly after your order is placed, from the US. Lyophilized peptides are shipped with insulation appropriate to season; short-term ambient excursions during transit do not measurably affect potency.
On receipt, store at −20°C in the sealed vial until reconstitution. See the handling matrix for full storage parameters. Tracked shipping is included; we ship to all US states and most international destinations.
What does reconstitution look like in practice?
Most peptides are reconstituted with bacteriostatic water (BAC). The volume depends on the target working concentration. Use our Peptide Calculator to compute volume, U-100 insulin syringe units, and doses per vial from peptide mass and target dose.
Once reconstituted, store at 2–8°C and use within 30 days. Protect the vial from light during storage and handling.
Can I return or exchange a vial?
Because peptides are temperature-sensitive research materials, we cannot accept returns of opened or unsealed vials. If a shipment arrives damaged or the seal is broken on arrival, contact us within 7 days and we’ll replace or refund.
See our full returns policy for details.

Don’t see your question? Contact our research team — we typically reply within one business day.

In the same category

Researchers also studied

IGF1-LR3 1mg

$69.99

Growth Hormone Support

View

KISSPEPTIN-10 10mg

$39.99

Growth Hormone Support

View

CJC-1295 NO DAC (5mg) + IPA 5mg

$69.99

Growth Hormone Support

View

CJC-1295 NO DAC 10mg

$69.99

Growth Hormone Support

View

Frequently paired

Often ordered together

Reconstitution BAC 10ml

$5.99

Reconstitution

View

NAD+ 100mg

$59.99

Cellular Health & Longevity

View

⚠ Important research notice

Not for human consumption. This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease.

All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims.

By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.

Tesamorelin 10mg

EgriftaTH9507trans-3-hexenoyl GHRH(1-44)Stabilised GHRH analogue