Is this product for human or veterinary use?

No. Aero Peptides materials are sold exclusively for in-vitro research and laboratory analytical use. They are not intended to diagnose, treat, cure, or prevent any disease, and are not approved for human or animal administration. By placing an order, you confirm that you are a qualified researcher and that the material will be used in accordance with all applicable institutional and jurisdictional regulations.

What does the Certificate of Analysis (COA) cover?

Each lot is independently tested for identity, purity, and mass using HPLC and mass spectrometry. The COA lists the lot number, test date, assay results, and the laboratory that performed the analysis. Public COA documents are being prepared. In the meantime, you can request a COA for your specific lot at /lab-results and we'll email it within 1 business day.

How is the product shipped and stored in transit?

Orders ship quickly after your order is placed, from the US. Lyophilized peptides are shipped with insulation appropriate to season; short-term ambient excursions during transit do not measurably affect potency. On receipt, store at -20°C in the sealed vial until reconstitution. Tracked shipping is included; we ship to all US states and most international destinations.

What does reconstitution look like in practice?

Most peptides are reconstituted with bacteriostatic water (BAC). The volume depends on the target working concentration. Use the Peptide Calculator at /reconstitution-calculator to compute volume, U-100 insulin syringe units, and doses per vial from peptide mass and target dose. Once reconstituted, store at 2-8°C and use within 30 days. Protect the vial from light during storage and handling.

Can I return or exchange a vial?

Because peptides are temperature-sensitive research materials, we cannot accept returns of opened or unsealed vials. If a shipment arrives damaged or the seal is broken on arrival, contact us within 7 days and we'll replace or refund. See the full returns policy at /returns for details.

Multi-Peptide Blends

GLOW (BPC-157 + GHK-CU + TB500)

Name: GLOW (BPC-157 + GHK-CU + TB500)
SKU: aero-56
Price: 139.99 USD
Availability: InStock

Skin & Tissue Research BlendThree-peptide research stackBPC-157 / GHK-Cu / TB-500 blend

A blended laboratory preparation combining BPC-157, GHK-Cu, and TB-500 in a single vial for multi-peptide research workflows. No peer-reviewed studies have characterised this exact three-peptide mixture; the literature base instead consists of independent preclinical work on each constituent. BPC-157 is a synthetic pentadecapeptide examined in animal models of angiogenic, nitric-oxide, and growth-factor signalling relevant to soft-tissue research. GHK-Cu is a copper-binding tripeptide studied for its interaction with extracellular-matrix gene expression, fibroblast collagen synthesis, and antioxidant pathways. TB-500 is a synthetic fragment of Thymosin Beta-4 investigated in actin-sequestration, cell-migration, and tissue-remodelling models. Researchers using blended preparations should be aware that pharmacokinetic, stability, and interaction profiles for co-formulated peptides are not established in the public literature, and that each constituent must be evaluated against its own published mechanism. For laboratory and research use only.

Dosage

BPC-157 + GHK-CU + TB500

$139.99

Peptide Calculator →

Quantity

Ships quickly after your order is placed

Damage protection

Secure checkout · 256-bit SSL

Research focus

How GLOW (BPC-157 + GHK-CU + TB500) is studied

Summary of contexts in which this compound appears in the preclinical literature. See cited studies for primary sources.

Areas of research interest

Multi-peptide research preparations
Extracellular-matrix remodelling models
Fibroblast collagen-synthesis assays
Angiogenic signalling pathways
Actin-sequestration and cell-migration research
Soft-tissue wound models
Copper-tripeptide gene-expression studies
Tissue-regeneration research

Technical specifications

Compound & stability data

Compound Information

What is GLOW (BPC-157 + GHK-CU + TB500)?

Blended research peptides (three constituents)

BPC-157
CAS Number
137525-51-0
Molecular Weight
1419.55 g/mol
Sequence
GEPPPGKPADDAGLV
Formula
C62H98N16O22
GHK-Cu
CAS Number
49557-75-7
Molecular Weight
402.92 g/mol
Sequence
GHK
Formula
C14H24CuN6O4
TB-500 (Thymosin Beta-4 fragment)
CAS Number
77591-33-4
Molecular Weight
4963.44 g/mol
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Formula
C212H350N56O78S

Storage & Stability

Handling requirements

Lyophilized (powder)
-20°C • long-term stable in sealed lyophilized form
Reconstituted
2-8°C • use within 30 days of reconstitution
Light
Protect from light during storage and reconstitution
Room temperature
Short-term tolerant during shipping; minimise extended exposure above 25°C

Compound-specific notes

Contains the GHK-Cu copper coordination complex — protect strictly from light to preserve the copper-tripeptide chromophore. Co-formulated peptide stability is not characterised in the published literature; minimise freeze-thaw cycles after reconstitution.

Dosing in the literature

Research dosing context

Observational summary of values reported in published research. Not a guide for human or animal use.

Reconstitution
Total vial mass spans three constituents (BPC-157, GHK-Cu, TB-500); per-constituent mass varies by SKU. Published practice for each constituent individually uses 1–2 mL bacteriostatic water per vial. Researchers dissolve gently given the GHK-Cu copper complex and the larger TB-500 fragment. The copper complex may impart a light blue colour on reconstitution.
Published protocols
No peer-reviewed study has characterised this three-peptide blend. Individual constituents have been studied separately: BPC-157 in tendon and wound models at 10–100 µg/kg (Chang et al., J Appl Physiol 2011; Gwyer et al., Cell Tissue Res 2019); GHK-Cu in fibroblast and ECM studies at 1–100 nM in vitro (Maquart et al., FEBS Lett 1988; Pickart et al., BioMed Res Int 2015); TB-500 in preclinical tissue-repair models at 50–500 µg/animal (Philp & Kleinman, ANYAS 2010). Combined-blend protocols are not standardised in peer-reviewed literature.
Half-life
GHK-Cu plasma half-life ~30 min; BPC-157 distributes rapidly in rodent models (specific half-life not formally characterised in cited papers); TB-500 estimated ~30–70 min in rodent plasma. Co-formulation kinetics for this blend have not been reported.
Post-reconstitution stability
~28 days at 2–8 °C protected from light, driven by the photosensitive GHK-Cu copper complex (consistent with the pilot GHK-Cu 100 mg file). Blend-specific validated stability data are not available in the cited literature; minimise freeze-thaw cycles after reconstitution.

GHK-Cu stability and dose ranges from Pickart et al. (BioMed Res Int 2015, PMID 26236730) and Maquart et al. (FEBS Lett 1988, PMID 3169264). BPC-157 ranges from Chang et al. (PMID 21030672) and Gwyer et al. (PMID 30915550). TB-500 ranges from Philp & Kleinman (PMID 20536453). No published protocol covers this three-peptide blend.

Sources & references

Peer-reviewed research

Frontiers in Pharmacology

Stable Gastric Pentadecapeptide BPC 157 and Wound Healing

Seiwerth S, Milavic M, Vukojevic J, et al.

2021 · DOI: 10.3389/fphar.2021.627533 · PMID: 34267654

Read on PubMed ↗

Cell and Tissue Research

Gastric pentadecapeptide body protection compound BPC 157 and its role in accelerating musculoskeletal soft tissue healing

Gwyer D, Wragg NM, Wilson SL

2019 · DOI: 10.1007/s00441-019-03016-8 · PMID: 30915550

Read on PubMed ↗

Journal of Applied Physiology

The promoting effect of pentadecapeptide BPC 157 on tendon healing involves tendon outgrowth, cell survival, and cell migration

Chang CH, Tsai WC, Lin MS, et al.

2011 · DOI: 10.1152/japplphysiol.00945.2010 · PMID: 21030672

Read on PubMed ↗

BioMed Research International

GHK Peptide as a Natural Modulator of Multiple Cellular Pathways in Skin Regeneration

Pickart L, Vasquez-Soltero JM, Margolina A

2015 · DOI: 10.1155/2015/648108 · PMID: 26236730

Read on PubMed ↗

Oxidative Medicine and Cellular Longevity

The human tripeptide GHK-Cu in prevention of oxidative stress and degenerative conditions of aging

Pickart L, Vasquez-Soltero JM, Margolina A

2012 · DOI: 10.1155/2012/324832 · PMID: 22666519

Read on PubMed ↗

FEBS Letters

Stimulation of collagen synthesis in fibroblast cultures by the tripeptide-copper complex glycyl-L-histidyl-L-lysine-Cu2+

Maquart FX, Pickart L, Laurent M, et al.

1988 · DOI: 10.1016/0014-5793(88)80509-x · PMID: 3169264

Read on PubMed ↗

Journal of Biomaterials Science, Polymer Edition

The human tri-peptide GHK and tissue remodeling

Pickart L

2008 · DOI: 10.1163/156856208784909435 · PMID: 18644225

Read on PubMed ↗

Expert Opinion on Biological Therapy

Thymosin β4: a multi-functional regenerative peptide. Basic properties and clinical applications

Goldstein AL, Hannappel E, Sosne G, et al.

2012 · DOI: 10.1517/14712598.2012.634793 · PMID: 22074294

Read on PubMed ↗

Annals of the New York Academy of Sciences

Animal studies with thymosin beta, a multifunctional tissue repair and regeneration peptide

Philp D, Kleinman HK

2010 · DOI: 10.1111/j.1749-6632.2010.05479.x · PMID: 20536453

Read on PubMed ↗

Cells

Utilizing Developmentally Essential Secreted Peptides Such as Thymosin Beta-4 to Remind the Adult Organs of Their Embryonic State

Maar K, Hetenyi R, Maar S, et al.

2021 · DOI: 10.3390/cells10061343 · PMID: 34071596

Read on PubMed ↗

10 peer-reviewed references listed. Citations verified against NCBI PubMed records. For research and educational reference only — does not constitute medical advice.

Researcher FAQ

Common questions

Is this product for human or veterinary use?
No. Aero Peptides materials are sold exclusively for in-vitro research and laboratory analytical use. They are not intended to diagnose, treat, cure, or prevent any disease, and are not approved for human or animal administration.
By placing an order, you confirm that you are a qualified researcher and that the material will be used in accordance with all applicable institutional and jurisdictional regulations.
What does the Certificate of Analysis (COA) cover?
Each lot is independently tested for identity, purity, and mass using HPLC and mass spectrometry. The COA lists the lot number, test date, assay results, and the laboratory that performed the analysis.
Public COA documents are being prepared. In the meantime, you can request a COA for your specific lot and we’ll email it within 1 business day.
How is the product shipped and stored in transit?
Orders ship quickly after your order is placed, from the US. Lyophilized peptides are shipped with insulation appropriate to season; short-term ambient excursions during transit do not measurably affect potency.
On receipt, store at −20°C in the sealed vial until reconstitution. See the handling matrix for full storage parameters. Tracked shipping is included; we ship to all US states and most international destinations.
What does reconstitution look like in practice?
Most peptides are reconstituted with bacteriostatic water (BAC). The volume depends on the target working concentration. Use our Peptide Calculator to compute volume, U-100 insulin syringe units, and doses per vial from peptide mass and target dose.
Once reconstituted, store at 2–8°C and use within 30 days. Protect the vial from light during storage and handling.
Can I return or exchange a vial?
Because peptides are temperature-sensitive research materials, we cannot accept returns of opened or unsealed vials. If a shipment arrives damaged or the seal is broken on arrival, contact us within 7 days and we’ll replace or refund.
See our full returns policy for details.

Don’t see your question? Contact our research team — we typically reply within one business day.

In the same category

Researchers also studied

KLOW (BPC-157 + GHK-CU + TB500 + KPV)

$149.99

Multi-Peptide Blends

View

Frequently paired

Often ordered together

Reconstitution BAC 10ml

$5.99

Reconstitution

View

GHK-CU 100mg

$44.99

Skin, Hair & Cosmetic

View

⚠ Important research notice

Not for human consumption. This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease.

All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims.

By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.

GLOW (BPC-157 + GHK-CU + TB500)

Skin & Tissue Research BlendThree-peptide research stackBPC-157 / GHK-Cu / TB-500 blend

Dosage

BPC-157 + GHK-CU + TB500

$139.99

Peptide Calculator →

Quantity